A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10150
Swiss-prot Accession number	Q7YQB8 (Sequence in FASTA format)
Description	Somatotropin precursor (Growth hormone).
Source organism	Hippopotamus amphibius (Hippopotamus)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Hippopotamidae;Hippopotamus.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues
Protein Length	216 Amino acids
Molecular weight	24477
References	1  PubMed abstract 15461431
Domain Name	Hormone_1
Hormone Name	Somatotropin
Mature Hormone Sequence	FPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNTQAAFCFSETIPAPTGKDEAQQRSDVELLRFSLLLIQSWLGPVQFLSRVFTNSLVFGTSDRVYEKLKDLEEGIQALMRELEDGSPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCAF
Position of mature hormone in Pre-Hormone protein	190 Residues from position (27-216)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10490
Swiss-prot Accession number	P69044 (Sequence in FASTA format)
Description	Oxytocin (Ocytocin).
Source organism	Hippopotamus amphibius (Hippopotamus)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Hippopotamidae;Hippopotamus.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the vasopressin/oxytocin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland
Protein Length	9 Amino acids
Molecular weight	1010
References	1  PubMed abstract 5406007
Domain Name	N/A
Hormone Name	Oxytocin
Mature Hormone Sequence	CYIQNCPLG
Position of mature hormone in Pre-Hormone protein	9 Residues from position (1-9)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated